DPCstruct | MC15055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803L9J4 | 550-607 | MINPVASILEIPLENIFANQMLFGDSGEFLGFDENEPTSRSGGKPIAVQQIRKARGYN |
| A0A2P2K3B0 | 1-70 | MINPVASMLGIPPENIFANQLLFGSSGEFLGFDENEPTSRSRGKANAVQQIRKVNHTYNCLLHVSLLKLK |
| A0A5A8CDI1 | 87-139 | None |
| A0A5P1FCI9 | 1-60 | None |
| A0A653DQQ9 | 65-124 | None |
| A0A1U8LVI2 | 1-67 | None |
| A0A5D2Q4L2 | 92-158 | None |
| A0A453AYM6 | 30-93 | None |
| A0A699YKA2 | 243-312 | None |
| A0A5D2PXM3 | 40-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.