DPCstruct | MC15053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 3 aa |
| Standard deviation of domain lengths | 3.38 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8LGU4 | 1-86 | MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDRGAFVAPSASVIGDVQVGRGSSIWYGCVLR |
| A0A6B2LFN4 | 1-86 | MSLGRVLSISGAATRATGRLIEKAGTNMQPGYRPLEAPSGHRRLVPTAEGVGPRLGYHTFVAPSATLVGGALVGKNCSIWYGAVVR |
| A0A453ESM2 | 74-157 | None |
| A0A5J4YML4 | 49-131 | None |
| A0A7S3ZYY5 | 1-85 | None |
| A0A0D2QLP1 | 1-86 | None |
| A0A3M7L3N0 | 393-478 | None |
| J9I0P2 | 442-536 | None |
| A0A811SPC7 | 1-86 | None |
| A0A2P6VIL1 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.