DPCstruct | MC15052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0YIQ3 | 39-103 | DFQTRRLNIRYRDKENKLRFVHSLNSTAMPTPRIMVSIIENYQQKDGSIIVPEVLRKYLGKDIIS |
| A0A2P2JQ13 | 22-85 | NNEQAKQYVHMLNSTLTATERTICCILENYQSQNGVEIPEPLRPYMGGKSFLPFQTNATPDAKG |
| A0A351Y4S3 | 3-66 | None |
| A0A2K5Z4P6 | 344-417 | None |
| A0A7S0TTQ8 | 46-107 | None |
| A0A0G1QAA9 | 21-83 | None |
| A0A4Q2Z3I0 | 145-210 | None |
| A0A1Y1V7Y4 | 5-62 | None |
| A0A820MKQ7 | 16-85 | None |
| U1R2U3 | 84-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.