DPCstruct | MC1505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 231 ± 31 aa |
| Standard deviation of domain lengths | 30.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.19 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 74.17 |
| Assigned Pfam label(s) | PF18592- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5JK66 | 1-235 | MSEINVSKLKVSELKAELASRSLDVKGNKADLAQRLQAALDEEEFGAISMPTPTVGDAATEAGNGTAAEPAEPAVEATPATTAEEAT… |
| A0A448YIL9 | 1-213 | MANYSSQTVAQLKELLKARGLTVNGVKADLIARLEESDKIDAELDEQEAQEEPAEAGQEVKKVEKVETVEAVKVVELPAQPVEPVAV… |
| A0A1X2GML8 | 2-238 | None |
| A0A0W4ZDN0 | 3-252 | None |
| A0A0D2Q7V2 | 1-192 | None |
| A0A0R3U294 | 2-259 | None |
| A0A078K9A1 | 1-248 | None |
| A0A4Y9ZFF5 | 1-257 | None |
| A0A427YL50 | 158-402 | None |
| A0A1M2W0V9 | 31-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.