DPCstruct | MC15048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 322 ± 31 aa |
| Standard deviation of domain lengths | 30.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9RJD8 | 710-1063 | RDHEGSACIDQRLAMQPFGDPLPGQLAGASETGLSHLGATQYQQEKVLLRRQEMHLRKMELTYKFRDLHLKEANLHLASETNSLMRE… |
| A0A2P2JMH0 | 1-291 | MEQARANDLKTLEIGLAMKKLKLKREQLDLSFDSNDLERSKLAMGRAEASFKTEKFKTQLEDARHAELLRKCLDCLVAGLFVMSASL… |
| A0A811NM99 | 159-454 | None |
| A0A835KHS6 | 1-328 | None |
| D8R7C5 | 545-834 | None |
| A0A2K1IMD5 | 445-776 | None |
| A9TQ82 | 605-989 | None |
| Q9LV85 | 254-564 | None |
| A0A7S0GTC2 | 366-720 | None |
| A0A090M7W7 | 181-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.