DPCstruct | MC15045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 156 ± 19 aa |
| Standard deviation of domain lengths | 18.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0NI83 | 1-156 | MGLKATLKKKNAKINNPNAYEEKRLYLNLKHQPNMDNPEDNYQFEFHAKKPENDEKHFWFKVEDILELKSVINYAREHNLGNKESEL… |
| T0DDR5 | 82-204 | TRTLKKKGARYDNPNAYEEKRSYLNLKHQPNMDNPEDNYQFEFHAKAPANNENHFWFKVGDILELESVWNYAEKHGIKGNALDLLEK… |
| N6YKH0 | 266-446 | None |
| A0A4Q3LBX4 | 167-335 | None |
| A0A0F9F7A1 | 113-281 | None |
| S3XCJ9 | 43-202 | None |
| A0A7W9L781 | 113-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.