DPCstruct | MC15042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 164 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1CLL0 | 97-260 | GDTMLYDTPEEWVGRSVGDVVGFRAGLVRGTTRLRVTEAAQPSRTLEEFQLLTLASESVESSVTFRRPPRGTIALSDTTPPYGPSAP… |
| A0A832CVM1 | 1-180 | MILILQYYRLSMVLGLNSVHAKKLNDKIIEELRLLALSSKPIDVRMELLKPPRLKISLSEELPPIGHRSPLEKPSILGNPNIPKVID… |
| A0A2K2VFN4 | 69-234 | None |
| A0A832UNK8 | 2-143 | None |
| A0A7C1W2U2 | 1-164 | None |
| B5I9I1 | 2-168 | None |
| A0A7C4MIP0 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.