DPCstruct | MC1504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0442 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5JIN6 | 1-77 | MLANHTCMSQLFTRSLQQFDRIRKRNAFVDNYRKEPMFADNLDEFEDSREVVASLIEEYKACESPNYINWGMGGAAA |
| A0A2G9T5X0 | 1-65 | MLNNNTSIAPLFERILQQFARLRSKNAFIDRFQKEEGFSVDMMDSSAERVHELIDLYAQAEKPDF |
| A0A7S0GK60 | 54-130 | None |
| A0A7S4KB26 | 8-91 | None |
| A0A7D9M6L2 | 1-78 | None |
| L0PAR0 | 506-571 | None |
| A0A183B6M8 | 36-108 | None |
| A0A812U4C7 | 86-163 | None |
| A0A7R8WGX1 | 155-220 | None |
| A0A2U1L6T6 | 56-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.