DPCstruct | MC15039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KQ49 | 11-131 | YDFMRSGFGPRTIILCDQCEKEFHVGCLRSHKMANLKELPKGSWFCCMDCSRIHSTLQKLLIRGAEKLPDSLLNDIKKKHEEQGLNI… |
| A0A7J7HZQ1 | 1-104 | MLCDQCEKEYHVGCLRDSGLCDLKELPRDKWFCWDDCNRIHVALQNLVLVRAEMIPASVSYAIHKKHVEKGFTDEVSNDVQWRILSG… |
| A0A446RMZ2 | 401-504 | None |
| A0A151SAG2 | 617-722 | None |
| A0A4V3WIT1 | 191-295 | None |
| A0A452XGA2 | 175-278 | None |
| A0A7J7DEM1 | 52-173 | None |
| A0A0V0IYE9 | 399-517 | None |
| A0A804JNV2 | 647-746 | None |
| W1PCY0 | 21-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.