DPCstruct | MC15038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9BF15 | 22-106 | PEEAARVAERHFLDLRKKYGSVLAIDLVNTTGGEGRLSEKFASAVQPILSDDLRYIHFDFHKICGHVHFERLSILYDQIADFLDK |
| A0A433PHR0 | 250-332 | TQAARRHFDELLRIYGRQILVNLTNTKGYELPVGQAYERIVDELHDDRLRYIHFDFHKECSNMRWHRIQLLLDQLEEDLVQQR |
| A0A453IB60 | 190-270 | None |
| A0A2P6MP81 | 703-792 | None |
| A0A4Z2EGV2 | 2-97 | None |
| R9NVL5 | 447-548 | None |
| A0A7S1PGT2 | 449-531 | None |
| A0A0D2QDN6 | 109-193 | None |
| A0A183B9Y0 | 12-101 | None |
| A0A843WL08 | 403-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.