DPCstruct | MC15036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 63.38 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0059- PF20736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5Q1B2 | 149-214 | GIESFSKLGDSIYFEEEGEVPGLYIIQYISSSLDWKSGQIMINQKVDPVVSSDPYLRVTFTFSPNE |
| A0A1D6P4W1 | 304-369 | GIESFSKLGDSIYFEERGERPALYVVQFIPSTFSWRTAGLTVAQQLMPLSSSDQYLQVSFSVSAKT |
| A0A4S8JI69 | 88-150 | None |
| A0A4U5QN63 | 64-128 | None |
| A0A287XED6 | 135-200 | None |
| A0A287XED0 | 244-314 | None |
| A0A287XE75 | 34-103 | None |
| A0A0R0HCE9 | 34-97 | None |
| A0A0D9WB80 | 163-236 | None |
| V4U5C8 | 196-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.