DPCstruct | MC15034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 20.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833SSP7 | 17-131 | DDLRKREEAVRNMAAMKDSASTVLGPRLKAWAEDNGRVKNIRTLLSTMHQVMWEGCKWTEVNMGKLIQPNDIKKHYRKAMIVVHPDK… |
| A0A7J7HSJ7 | 16-149 | QQPHSKTRVISVSEISVGQKDASASSSVECINYTLLINPMQISDAKIQKWSNGKEGNIRSLLSTLQYVLWPGSGWMPVPLVDIIEGS… |
| B9H7I6 | 364-536 | None |
| A0A1U8EHU7 | 83-202 | None |
| R7QNA7 | 121-297 | None |
| A0A4Y7L5N1 | 102-259 | None |
| B5VGJ9 | 86-229 | None |
| A0A7R9KWE1 | 593-734 | None |
| A0A6D2JTJ4 | 26-195 | None |
| A0A834NNK5 | 528-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.