DPCstruct | MC15033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 143 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438FW45 | 292-430 | LSNFGMGSDIEGKVSSFNSLEELTIEVSSSKLWWDKIVDTVKKEVAALEKLTSLRFCFPEVDCLELFVTTSPVWKKNSCMSFQFASG… |
| A0A7J7GTR9 | 606-751 | SKIIPQLRSLQTLSIVVHPVDWRWKNNARAITPDVSSLNELTNLQFYIPEVDLLQLFTQKSLSWKAGRLGKFKLVIGQDIKRIVSRV… |
| A0A2I0L2Q9 | 392-529 | None |
| A0A438FW55 | 154-291 | None |
| A0A438FW28 | 1-141 | None |
| A0A2U1PZQ4 | 144-281 | None |
| A0A6A6N7E6 | 247-405 | None |
| A0A830D2X5 | 393-544 | None |
| A0A2U1P4X2 | 65-195 | None |
| A0A1R3HI82 | 128-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.