DPCstruct | MC15031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835LWC1 | 72-141 | GEFSNVVSRPAVVNIGAIFTLGTINGQVSKIAMEAAINDVNYDPSFLGGSKLNITVHDSNFSGFLSIIGG |
| A0A2U1MH31 | 1-60 | MFVTSSKRPDVVHVGALFSFDSVIGKAAKIAMEEAVIDVNKDLKILNGTKIKILPQHFTL |
| M1B681 | 14-79 | None |
| A0A2U1PFM6 | 16-71 | None |
| A0A5J5AAY9 | 152-207 | None |
| A0A444Y6V1 | 35-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.