DPCstruct | MC15022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0ZD70 | 302-385 | NEITAKIDAKQAYHAAIRRILIEKFSEGELRTLATDLGVDYDNLPDSGKANKARELVLFLDRRDQLPQLVQVGKHLRPTVEWPS |
| A0A2E0ZAF0 | 96-168 | NYLVELLHNVNSDFNEQELKELCFELDVDYDDLPGPARKDKCREFIDLLKRQKRIPEFIQICRNKRPNTLWHD |
| A0A2G6P8N1 | 47-129 | None |
| A0A6L3F4P0 | 25-119 | None |
| A0A6L3ERB5 | 1-69 | None |
| A0A2E0USQ0 | 119-192 | None |
| A0A7C3QRI0 | 87-151 | None |
| A0A800CIL8 | 4-80 | None |
| A0A7C7UEK3 | 5-74 | None |
| A0A7Z9Y5A4 | 163-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.