DPCstruct | MC15020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 21.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DAU1 | 220-348 | DKLTVEQDFMSGIDTDKNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRENRVTLIFFLGGV… |
| A0A2U9CGV8 | 22-138 | TYQLSRWTPLVKDIMEDAIEDKLDTKHYPYISTRSSASFSTTAVSSARYGHWHKNKTPGEYRTGPRVMVFIIGGVSFSEMRCAYEVT… |
| J5QMJ9 | 933-1060 | None |
| J6ERX2 | 366-471 | None |
| A0A086LCD6 | 166-269 | None |
| A0A6V7PHY1 | 251-422 | None |
| L1LAP7 | 990-1100 | None |
| A0A819YAM2 | 22-114 | None |
| W2P9C1 | 177-303 | None |
| A0A2P4ZBU4 | 718-891 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.