DPCstruct | MC1502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.54 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF14260- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183RZU3 | 1-82 | SALCKYCESRASEIYQKEIVQLNLLEKKFTSLWTECQRCQQSIHEEVICTSRDCPIFYMRMKSRKDVDEAYKTIQRFGNPNW |
| A0A0K8WJ03 | 1-102 | MTKKSSCLGCRALMPNGYEKAALCPHCEPRMSELYQREIVAKRSLEETFDRLWTECQRCQGSLHEEVLCSNRDCPIFYMRQKIRMDL… |
| A0A7S2LEH8 | 1-103 | None |
| A0A4S8LR00 | 208-312 | None |
| A0A4U0WPI7 | 275-374 | None |
| A0A6P6BLI5 | 401-499 | None |
| D5AEH5 | 131-225 | None |
| A0A7S1HIS8 | 155-261 | None |
| A0A812VK83 | 86-183 | None |
| A0DPB1 | 242-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.