DPCstruct | MC15018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.43 |
| Pfam Score | 99.56 |
| Assigned Pfam label(s) | CL0027- PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W6EG72 | 126-194 | CRSCAVVGNSGNLRRSGHGSLIDSHTFVIRMNKAVTRGFEKDVGNRTTHHFLYPESAVDVAKGVSLVLL |
| A0A2U9C4L9 | 97-163 | MHCRTCALVTSSGQLTGSRRGEEIDRSECVIRMNDAPSEGCQRDVGQRTSLRVIAHSSLQRVLRSRQ |
| A0A5B8MZT6 | 310-398 | None |
| A0A498NRN9 | 57-127 | None |
| A0A498NS27 | 3-67 | None |
| A0A3L8SDT9 | 64-136 | None |
| A0A498NSX6 | 73-138 | None |
| A0A2K1JE63 | 76-140 | None |
| A0A7M4FIN9 | 59-131 | None |
| V9L8L8 | 143-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.