DPCstruct | MC15017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 702 ± 81 aa |
| Standard deviation of domain lengths | 80.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.73 |
| Pfam Score | 88.79 |
| Assigned Pfam label(s) | CL0689- PF11598- CL0053- CL0004- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7VCA2 | 8-583 | GKSYTGSKNQTCADVDECAFNNGGCDVNSFCYNTIGSFYCGFCHKGYLGDAHYGCYDDNFCRSGADKCHAQARCSYAGPGEYRCQCQ… |
| A0A3R7QCY9 | 152-838 | RFFSCESAGSKPEGYRCQDNMIFDEALGLCRNKESTLSCTEAGLFAIPKSCSDYFSCIPLRHGWVQRFYMCTNNRYFSQKSEACKDP… |
| A0A7M5U9K6 | 237-1024 | None |
| A0A6J8B379 | 1-711 | None |
| A0A5N4AN02 | 386-1195 | None |
| A0A556VTY1 | 76-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.