DPCstruct | MC15014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 33.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12959 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2QVZ3 | 41-145 | TVDYNELLYNKMKKEFDSFMSELKTKPPEQIIEGSYEKVIKEDLLAIFEYTEFSQAEAKSLYRLKAPLDDIYQEWCGNDMSYCDMLR… |
| A0A3D0XE99 | 1-117 | MQNEQELRDLLYEKMCNEQENFIEKLKHSTPEEIISASYEKVMRDDILMLFESDFLDAKQIKELLRLEYPLSACYNEWLKNDYSYMD… |
| N2A1V6 | 1-107 | None |
| A0A1Y4T5G9 | 1-110 | None |
| A0A6I3QUR5 | 62-163 | None |
| A0A645C609 | 1-119 | None |
| A0A373Q0T2 | 208-312 | None |
| A0A1I0D3D3 | 1-108 | None |
| A6NZN8 | 1-104 | None |
| R6MYD6 | 12-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.