DPCstruct | MC15013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 209 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19845 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345C3S3 | 3-181 | SKLRNLKQRVFLFIAIFIISSSLLINLLTTPNELWVFYIVGPVLYALLCINHTILSKAHAGSKIIFQVLALSAMLIVIDVTAGATRW… |
| N2AGL6 | 23-223 | CVVEQKDESTEQERYPDIRLKGRRLELVSRIALFLAIVLGALAVTLNSVMDSDMWWSVIVIGALAYLMLFLFYIIANEHAGYRSKVI… |
| A0A1V5Q8D9 | 75-282 | None |
| R7L3S3 | 108-309 | None |
| R5MMB4 | 25-254 | None |
| R7K924 | 24-219 | None |
| A0A1G3LX26 | 3-240 | None |
| A0A7X8JE45 | 40-259 | None |
| A0A7X7MVT6 | 183-388 | None |
| C4GA73 | 121-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.