DPCstruct | MC15012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9JG01 | 90-184 | ERAKEYEAFGVTYDIKNDQWYFNGEKVRFFRDVRTSNGEDLTGGKFKGAIRTLGSADGTVDIYTVRDFARPDASGNGTLTGVEKYSQ… |
| N2ABB0 | 54-144 | LDKARDEKSLFDEYAACGIERKGGSYYYEGKRVKVIKDRSVDSSFYKFDPKLKGKVSIKVVRNKKGKIRRVSYMTKKEASKLIRRAG… |
| A0A358ARN3 | 93-170 | None |
| A0A3R6LRD8 | 7-112 | None |
| A0A2S0U5M9 | 72-160 | None |
| A0A1C6G833 | 36-121 | None |
| A0A645JB10 | 1-104 | None |
| A0A395Y777 | 46-135 | None |
| A0A3C2EPF0 | 119-222 | None |
| A0A4U8Q6W7 | 241-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.