DPCstruct | MC15011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 3 aa |
| Standard deviation of domain lengths | 3.25 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350YE53 | 1-104 | MVNRAGKPYPSVIDPRTNNPIPFATGDLVKVPKSDRVAWGRKERGEYIAEWYRRGYDTPPGGWNLYDIHHIKPREYGGTNDFDNLVP… |
| N2A6G4 | 33-131 | CINRTGHIWVWNHKDYLSGKTMNEPYTSYEKKALYTRPSNLNTTYKKWYDGVYNTNWNLSGYDVHHIRPLAYGGDNTMGNLIHLEKT… |
| A0A4P8A5C8 | 68-168 | None |
| A0A517D8G4 | 204-305 | None |
| A0A3A9IW66 | 53-151 | None |
| A0A371NYJ1 | 281-384 | None |
| A0A841U807 | 235-344 | None |
| A0A3R9BCF1 | 161-264 | None |
| A0A109WG07 | 78-175 | None |
| A0A2I6SDE7 | 15-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.