DPCstruct | MC15010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6QHR1 | 89-138 | YISVSEYAALHNKGQRIVTRFCNEGRIPGAIQRNYRWLIPADAPYPERAS |
| N1ZRG2 | 2-55 | FEYMTAQEAAEKWNVSLRWVQRLCKENRIEGAMNINRVWLIPIIAEKPIDRRKK |
| A0A4R3JX21 | 2-61 | None |
| C0FRE5 | 34-93 | None |
| A0A7Y5E3S0 | 21-102 | None |
| A0A6A2TE20 | 1-48 | None |
| A0A1G4X0Y4 | 14-76 | None |
| A0A7X3MH89 | 1-57 | None |
| A0A7X4ATF9 | 77-130 | None |
| A0A061AAI2 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.