DPCstruct | MC15006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7CI02 | 1-89 | MFTFVKVYHIARSLETDAEKKTFLSYADAIFSARLKPNGMRWECFIQECPRDVWKINGLTPPTQGSAREKLWRERNEPVEVDGLNDD… |
| M5C3S2 | 58-140 | FARFNVQHLARSFPDKESKLHFMQAYEKVLKPFTADKGLDWEVNVDEADQLLWHMNGMSPPAPDSEGEQLYLKLNKVVPFEGP |
| A0A146H8X1 | 600-679 | None |
| A0A5M3ZCC4 | 64-145 | None |
| A0A094FDT2 | 50-148 | None |
| J3P542 | 67-163 | None |
| A0A146H7Z8 | 67-151 | None |
| A0A3M7LV37 | 136-234 | None |
| A0A1V6PZR8 | 71-160 | None |
| A0A135UJY4 | 50-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.