DPCstruct | MC15005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 212 ± 28 aa |
| Standard deviation of domain lengths | 27.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150VJ72 | 8-216 | YINTAIKLGEFILRLQAAPEECRVFGRLIQRVRTDRAEALRERHDKSTALEDFTEKRKWIDDTIQDATEALQTIGRLVEGARIDVAR… |
| A0A5N7CFW8 | 28-234 | SNNDPIPSPSPTSRRQPTSVSEQTSELLKTTDHIRTQLREVERLRQLHDHILGDDERAWIDSTIQDIAGAARDVAVLIEPTRVEVEA… |
| A0A5N6KT88 | 28-230 | None |
| A0A1V6U1Z0 | 6-206 | None |
| A0A0F8WW25 | 2-195 | None |
| A0A2J6TI48 | 30-251 | None |
| A0A194XR19 | 26-244 | None |
| A0A1J9RF44 | 3-161 | None |
| A0A1V6V6F2 | 106-317 | None |
| A0A2S6CNH0 | 3-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.