DPCstruct | MC15004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 165 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9Y1U0 | 273-464 | ICALAQRMHHARCRWKGNSIQDARSCRRGNMTQDASIHNTLDTINRTLEQWQPNVPDDFLQGRFTTTETVLILAQAKVLRLAALLMT… |
| A0A1V6Q4R1 | 1-160 | MDVGLAQQLKAIQDCLDQWQPLPPPGFLEQFVQDEIVRMIAQTEVLRLAALLIIHRLKHPFGRHDEEALLISKAITAEFDMVMQVTG… |
| A0A4Z0YFB1 | 143-300 | None |
| A0A1L9WJF7 | 86-248 | None |
| A0A0D2IIA7 | 298-466 | None |
| A0A1L9MW01 | 198-342 | None |
| A0A084G321 | 602-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.