DPCstruct | MC15000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 363 ± 85 aa |
| Standard deviation of domain lengths | 85.26 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420RYD5 | 2-347 | FLRCLQFSYTGGLIQKAAGCWRDVRQQPDASQPNGLRRHEGLGFKLTMERHGYAWFLDKIDWSTLTFRQPHAPYMMFNNPSMQNVYR… |
| A0A5N7BQS8 | 1-351 | MVYSLNNCHFITWEYIRVMLMFLRCLQFSYTGGLPQRVSGCWRDVWFQPDPRQPDGIRRREGLGFQRSMDQYGYAWFQDKLNWDTMT… |
| A0A2K0W1K7 | 165-563 | None |
| A0A2V1D3Q7 | 57-467 | None |
| A0A6A5V638 | 1-211 | None |
| A0A2H3FNH9 | 92-487 | None |
| A0A3N4IXG5 | 2-273 | None |
| A0A3N4IXJ9 | 489-835 | None |
| A0A366S461 | 515-878 | None |
| A0A094IB87 | 23-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.