DPCstruct | MC1500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 322 ± 31 aa |
| Standard deviation of domain lengths | 30.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9PK04 | 196-507 | KLYALLTLKISQKPNGFFDLLRINKPLDNPIWWDFVLECPQGYIQIWRTPFLIEAKYQFDGDIDLELFFNSNIERYKDEIKSAIKNF… |
| A0A1X7AAY4 | 7-359 | HWEKPSPREMLDFMDRPKTTGKPSGSMLVFRKQLSPLSVYKYLVARFGQPYGFQTMAKKPHDSDNLFHWDYLLRAGEAWIYLQGGNR… |
| A0A1I5KPG9 | 19-310 | None |
| A0A327W5N5 | 63-390 | None |
| A0A2N7X3X4 | 2-270 | None |
| A0A0F2R4V2 | 4-274 | None |
| A0A0P6YN54 | 4-325 | None |
| A0A7Y9NIC3 | 1-324 | None |
| A0A5D0SPC4 | 38-367 | None |
| A0A6H1W2X5 | 303-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.