DPCstruct | MC150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7FSZ1 | 6-89 | SLPIKNTFYFGKSNYLWMLIGIVLIALGFILMMGYGANTKPDGTFDPNYWNEDIFSIRRIRIAPLLIFLGFVAEGYAIMKRTKK |
| A0A519M904 | 2-76 | NTHFLFEKVNYKILLIGIAVIALGFILMSGGGSDDPKVFSEAIFNFRRIRLAPTVVLIGFGITIYAILKNPHAPV |
| A0A1V5VXQ7 | 5-91 | None |
| A0A1Q3UFV4 | 2-69 | None |
| A0A4Q0P5Z1 | 2-62 | None |
| A0A1Q6FYF3 | 3-83 | None |
| A0A2G4H7S3 | 18-98 | None |
| A0A2G2F1E3 | 24-109 | None |
| Q26HK9 | 17-100 | None |
| A0A3B8QPN8 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.