DPCstruct | MC15
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 234 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067W605 | 2-192 | HLSKIVYGNPKILNEQIKMITNNPKVSKQLSTQIMSSPNSIANLAGIEIFGMKNLARKKAGNHIIKLANSIDSYASAIKNVETTIIQ… |
| I5BT15 | 107-386 | GVRIGLFDATLSAVQLKKEAEPMVKGVTTFSRSISDVATGKVHAEREVARQWEEVSDRFRLVFADPETAFRAMRFDAMLTDPATASE… |
| A0A840NVN3 | 129-363 | None |
| A0A7Y3TDY7 | 3-240 | None |
| A0A5P9C252 | 306-560 | None |
| A0A1S6XHK1 | 452-662 | None |
| A0A1S6XIH2 | 36-284 | None |
| A0A1S1P2Y8 | 8-257 | None |
| A0A2M6URS4 | 387-619 | None |
| A0A4R5VH83 | 825-1095 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.