DPCstruct | MC14998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 191 ± 38 aa |
| Standard deviation of domain lengths | 38.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 92.09 |
| Assigned Pfam label(s) | PF00926- PF00925- PF12471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838VTC4 | 1-155 | SDVFGSDICTCRPYLAHGIEVCVQTAQEGGVGIIIYCRKEGRALGEVTKFLVYNARKRQVGGDRADAYFSRTECVAGVQDMRFQELM… |
| A0A7D6Z9L1 | 30-219 | RTRHSLTRLRHKIDMRCVPLPDNSGHVVIFGDAEFRRHPFVRIHSRCLYGDVLGSDDCDCGPELQRSIATMRASGAGILVYLEQEGR… |
| K9PWL8 | 206-403 | None |
| G8BC40 | 157-412 | None |
| A0A838LA99 | 437-624 | None |
| A0A7X7QFL5 | 52-263 | None |
| A0A511D354 | 8-194 | None |
| A0A1R0H4G5 | 44-280 | None |
| A0A6N7G1R2 | 14-213 | None |
| A0A511D5Z4 | 215-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.