DPCstruct | MC14997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 386 ± 47 aa |
| Standard deviation of domain lengths | 47.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376ZGH9 | 3-346 | KELPWLADNAQLELKYKKGKTPLSHRNWPGEPVPVITESIIQTLGDELLQKAEKKKNIVWRYENFSLEWQSAITQAINLIGEHKPSI… |
| A0A7D6Z508 | 1-428 | MPPQYNRAPTRLSVSAGKIMAMADENTWTLPAAWWEQAEPFRGLNQVRPEPLRPYATVHVQQLLHGNRRLVDTVLTAARDDGLHEFA… |
| A0A6G3I5M9 | 7-426 | None |
| A0A4R4ZZP7 | 3-402 | None |
| A0A2S8BJC1 | 92-388 | None |
| A0A2Z5J6C2 | 1-355 | None |
| S1EIR3 | 109-548 | None |
| A0A376Y6U6 | 1-420 | None |
| A0A345XSA4 | 1-400 | None |
| A0A7V9RGB2 | 4-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.