DPCstruct | MC14996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0VKF2 | 22-108 | DKISVLAKQIKLSFPGAITTLEIFSSCSAMLDIRLNNKLFVLDYSPTNGFGIDEVREEDAFNTGYRFNTKDFYIATEELNKLIKSTE |
| A0A7D6VAD6 | 3-89 | DSVHDAVRTAHELFGPVAEVSATEFPSGALDLVIRRSGRIVVIQGLNGVWGVSVDISRGEEFTGHQQAFSSLDEALHAAKNSIDNPK |
| A0A2V9CI42 | 1-91 | None |
| A0A2V2S2Z0 | 1-90 | None |
| A0A1V4HBE0 | 1-86 | None |
| A0A4P5QQF7 | 1-88 | None |
| A0A7V3G034 | 5-90 | None |
| A0A841GZQ2 | 1-105 | None |
| A0A0L0LPA9 | 1-89 | None |
| A0A2A2WD59 | 33-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.