DPCstruct | MC14994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 20.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848D066 | 6-114 | RASIETFKSNPKVFSGKSAEEIAKMLEDAGYKVTVQASKRSRSGAKIIKIQNTGREKNITQVQVSPGGGRHGDSPYVKISTSDQGII… |
| A0A7X1PPH8 | 10-137 | SGSSKLSKVTDGSSGSGGQAAKANINIAKDFISKPQSIWGRSADEIANDFRAAGYEINVRQSTRGSGQALIVEVKGHPQISQIQVHP… |
| A0A836MNR5 | 70-188 | None |
| A0A4Y1KH88 | 70-174 | None |
| A0A837KNV0 | 57-210 | None |
| A0A829R4L4 | 197-341 | None |
| A0A127PD59 | 205-338 | None |
| A0A2T5RX88 | 178-311 | None |
| A0A1Y3NWJ0 | 6-102 | None |
| A0A2V3QRZ8 | 392-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.