DPCstruct | MC14992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9H7I1 | 15-166 | APWEFYGSSVCEPDNKAGHNVLASPPGPEDQYDEDKANSDVFEFEFSDSPLLPCYNVQVSVYQGARNWFLLSDVLKKLKMSSCAFRC… |
| A0A6P3I7G4 | 2-135 | FEFEFSESPLLPCYNVQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKEL… |
| E7F0N0 | 1359-1514 | None |
| A0A182SK01 | 101-246 | None |
| A0A7T8KHU3 | 68-177 | None |
| A0A3B3DLE2 | 47-201 | None |
| A0A2R8QG42 | 8-145 | None |
| A0A4Z2C4L2 | 497-660 | None |
| A0A6F9AZA5 | 25-174 | None |
| A0A0L0C6I5 | 169-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.