DPCstruct | MC1499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 203 ± 20 aa |
| Standard deviation of domain lengths | 20.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0NGK8 | 7-189 | LDKHMDNLRIQFAGKPELLFHHAKLIVLVRREFDTHENYRRFRALWERESAFLRERSDLRWLVSAADTFADHDEDPLTRATAMMTSL… |
| A0A1X6Z6R8 | 30-245 | FAEGEAFPPLDLDLAPLAAQRVAHPDSDPAEAPPFRSSYHRKRHDLRCEFEGESELAFLNALLIANLRKRGYPAHVPALFQRLWSEC… |
| A0A2E2EVD2 | 22-220 | None |
| A0A1W6ZKQ0 | 205-371 | None |
| A0A3M0ABK9 | 24-240 | None |
| A0A1Y5GFF7 | 149-372 | None |
| A0A2W1MQQ9 | 119-321 | None |
| A0A5P9H608 | 27-238 | None |
| A0A6H2KWR3 | 14-217 | None |
| A0A1T4PDI5 | 544-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.