DPCstruct | MC14988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 418 ± 103 aa |
| Standard deviation of domain lengths | 102.98 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 52.40 |
| Assigned Pfam label(s) | PF14288- CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1C363 | 1-366 | MLQLKDLEHKWRVRMEQMPDTEKLQQLALWLMLWGEASVIRFCPELLCFIFKLADDMLRENPSIDSVQEGDYLDNVITPLYIFIRNQ… |
| A0A7J9NBD4 | 78-437 | FFCFQHENFKNQREHLVLHLANSQMRLSPLPENIDTLDAGVLRTFCQKLLKNYTNWCFYLGKKSNVWISKSGHSNSDHSRELLYVGL… |
| A0A835RI76 | 1-326 | None |
| A0A835R3F1 | 301-670 | None |
| A0A287HXB3 | 98-518 | None |
| A0A388KY40 | 154-605 | None |
| A0A2P2MBJ8 | 261-650 | None |
| A0A438DAG5 | 42-352 | None |
| A0A2N9INZ6 | 1-319 | None |
| A0A287Y0V3 | 2-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.