DPCstruct | MC14987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 64.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 74.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9N0U2 | 1-57 | MDYNEDIVGGNGNGDNGGNGKPQVGKKKPKRKRDKLKCFLCDGPHMLKKCPRKSALK |
| A0A7J9N690 | 1-70 | MDHKEDIVDGNGNGNVSGNGKPRVGKKKPKRKRDKLKCFFCDGPHMLKKCLKKSALKEKPVGKALVVEVS |
| A0A7J9D5Q9 | 1-78 | None |
| A0A7J9DMM2 | 30-105 | None |
| A0A7J9GMG0 | 46-106 | None |
| A0A7J9ETG2 | 30-105 | None |
| A0A7J8VQU2 | 3-76 | None |
| A0A7J9NC31 | 1-78 | None |
| A0A7J8W7Y6 | 22-99 | None |
| A0A7J8W6U7 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.