DPCstruct | MC14983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A856UU98 | 18-80 | SSLLRGMLRGIERESLRMQSNGFLSQAAHPKGLGSALTHPHITTDYSEALMEFITPPQDSIPG |
| A0A377TXZ6 | 1-71 | MIPDVSQALAWLEKHPQALQGIQRGLERETLRVNADGTLATTGHPPALGSALTHKWITTDFAEALLEFITQ |
| D1KAQ5 | 1-76 | None |
| A0A1V6DXJ3 | 8-80 | None |
| A0A4R5NKS3 | 2-77 | None |
| A0A139PAH5 | 1-75 | None |
| A0A401FNV5 | 1-77 | None |
| A0A127T2A1 | 3-77 | None |
| A0A378AEI8 | 3-78 | None |
| A0A090RMJ7 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.