DPCstruct | MC14981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844F2R7 | 52-142 | EALAEERENNGVRSLDNVTVSTITSHKAGYIDKENELIVGLQTDELLKRAIKPFGGINVVSKACHENGVEVDDRVKDIFTHYRKTHN… |
| A0A377TXD7 | 1-71 | MDFDTNVATSITAHAAGYINQPLEKIVGLQTDQPLKRALHPFGGIKMIKSAFEAYGREMDPDFEYQFTAAA |
| A0A4V3ITQ9 | 2-76 | None |
| A0A376ZR41 | 1-80 | None |
| A0A7H4UI28 | 62-137 | None |
| A0A377E5Z7 | 59-138 | None |
| T0E668 | 1-78 | None |
| A0A377CXL8 | 2-66 | None |
| A0A377LHC0 | 1-80 | None |
| D6XC58 | 200-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.