DPCstruct | MC14980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 238 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017HEE1 | 331-576 | DVVLPTATWYEKHDLNTTDMHPFIHPLTAAVDPSWEARSDWNIFRGIAQKFSEVAPEVLGVEHDVVLMPTLHDTPSEIAQPYEPKDW… |
| A0A377TWE9 | 2-231 | NTSDMHPFIHPLSAAVDPAWEAKSDWEIYKDIAKSFSQVCVGHLGKETDVVLVPLQHDSPGELSQPFEVLDWRKGECDLIPGKTAPS… |
| A0A1Z1WSB6 | 126-363 | None |
| X7YBV1 | 720-939 | None |
| S7SSX3 | 225-478 | None |
| A0A7G1I9A0 | 15-229 | None |
| A0A379UPU0 | 184-368 | None |
| A0A378F4Z1 | 333-590 | None |
| A0A7C5L3H1 | 133-388 | None |
| A0A014M4M6 | 19-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.