DPCstruct | MC1498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510IH61 | 1-62 | MAAWNKGKRVGQKKAFKLEDIWRIRIRLELEERLFELALFNLAIDSKLRACDLRNLKVQDVS |
| A0A0D6E9V1 | 3-66 | VPTEISFTPWNKGKLVGQKAPLRLRDIWDIRVRLQLAKKTRDLALFNLAIDSKLRGCDLVNLRV |
| A0A167N0I9 | 1-69 | None |
| A0A6P2F6Q9 | 28-101 | None |
| A0A1G0AU32 | 1-62 | None |
| A0A3E0BZI7 | 3-73 | None |
| A0A1H3SGA8 | 1-60 | None |
| A0A3A1VV05 | 1-74 | None |
| A0A7W6T8D2 | 73-133 | None |
| A0A4R1VBQ1 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.