DPCstruct | MC14979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 53.83 |
| Assigned Pfam label(s) | CL0123- CL0010- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1DCC6 | 3-160 | IELIDGKDYFKIKYADEDKLFVPLESIHKIEKYVHVPGVVPEIYHLGTRGFQRKREKLQEEILEFAKEIVEIQARRNSTQGFRYSPD… |
| A0A377TQ77 | 316-490 | LHIGQPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEENAPLHKLGGDAWTRARQKAAEKVRD… |
| D8LDP5 | 2-168 | None |
| A0A7C5J6A2 | 2-156 | None |
| A0A837PYP3 | 312-420 | None |
| A0A524RR41 | 1-161 | None |
| A0A379UN59 | 2-155 | None |
| A0A3A1VQN2 | 209-387 | None |
| A0A7V2HXU7 | 240-408 | None |
| A0A7C7EBQ9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.