DPCstruct | MC14977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 56.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6HCH2 | 83-144 | MKSTNIVGSFGSGGITEAFTDMLHEGLLRELFDVQAFDLAAVKSSREDPMHHRISASRYANP |
| A0A099DBR2 | 1-53 | FALGGITSPIVDLHEKGLIRKLLDVQSFDKAAAESLGRNPNHIEISANQYACF |
| F8GUI5 | 29-90 | None |
| Q7P3N2 | 1-67 | None |
| A0A6M1I0P4 | 66-130 | None |
| K8DCP9 | 1-62 | None |
| A0A6D0FAB5 | 134-195 | None |
| A0A1H3QA45 | 301-362 | None |
| A0A0B8PNU9 | 101-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.