DPCstruct | MC14975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1VZY8 | 3-65 | TIILVEPKYSGNIGSVARVMKNFDFHNLYLVNPCDLNDEGYRRAMHAVDILENAKIFQSFEDA |
| A0A377TL17 | 3-64 | LTIILVGPARAENVGAAARAMKTMGFRELRIVDSEAHLAPPARWVAHGSGDILDGITTYPTL |
| A0A3N9N461 | 19-77 | None |
| A0A2N6DHK4 | 3-61 | None |
| A0A662TWA2 | 1-67 | None |
| A0A1F9HBF0 | 8-72 | None |
| A0A534H4Z0 | 7-66 | None |
| A0A124G3Y5 | 1-61 | None |
| D8TRL1 | 5-68 | None |
| A0A151QGV8 | 13-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.