DPCstruct | MC14974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 185 ± 18 aa |
| Standard deviation of domain lengths | 18.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0264- CL0287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377Z1N1 | 49-227 | RAIVGFGHSFIANPRFLRTLSDLTGLPTYNFGRSGGLSRTVALRAGAYTVSYEPVGGLIPESGPVVLSPADPGVLQIVGNAALSETV… |
| A0A377TIG7 | 216-393 | PKIVGWGHSFMENGRFLSRLAQLTGLYTYNFGKSGLTSEGVASRQGAARTFYTPAGGVIPASGAVTLSPAKPGPNRIFGNAAATSIA… |
| A0A2W1PBE8 | 50-218 | None |
| A0A172YG33 | 117-331 | None |
| A0A6I4TUN8 | 453-647 | None |
| A0A545B7W3 | 555-753 | None |
| A0A0Q4DNT1 | 22-201 | None |
| A0A1V0GVT5 | 265-456 | None |
| A0A260WFW1 | 166-340 | None |
| A0A427CT03 | 288-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.