DPCstruct | MC14973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 54 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377TKN7 | 5-50 | PPLGSTSPAVLLDNATRLDNLLNSLALVYPDREGADLDTWRGIMSR |
| A0A377THC8 | 1-63 | MAELNPPLGTTTPEIFLDNVKRADELVNGPAGTVNDRAGEPLDTWRQMMAKNDEVRQKHHPAQ |
| A0A378H483 | 1-56 | None |
| A0A378FZ07 | 1-72 | None |
| A0A377ZFR1 | 1-67 | None |
| A0A378BYR8 | 1-46 | None |
| A0A7H4SJT8 | 40-90 | None |
| A0A443WQF4 | 3-50 | None |
| A0A7H4PJY8 | 1-51 | None |
| A0A8A7Y500 | 1-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.