DPCstruct | MC14969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G3JT65 | 6-143 | IRRGRGFWGDIERYVVPSAYSDNQYAYVAADMETVKQPLSKSVIAEAIATPVMAIPPSPQPVIDDDLPSTVLSEESAALAEDIRQIK… |
| A0A7C4YC53 | 253-374 | VGLSSAVQAVSEFAAVSDIQQSRLGDRNIENVKENRQSKPVHPAEEKRQHTVQQEHSRSGEQITEEVASLRSRYIVGKVAGDTLLDN… |
| A0A1V5LPV4 | 74-218 | None |
| A0A831TPY1 | 143-266 | None |
| A0A7X8FBY0 | 65-161 | None |
| A0A1V5PCU8 | 1-122 | None |
| A0A1S9CKK3 | 211-337 | None |
| G8LY51 | 306-410 | None |
| C9RCL1 | 170-250 | None |
| J4TVE4 | 38-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.