DPCstruct | MC14965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 162 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.63 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF02212- PF01031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6EMN6 | 257-418 | ENSMKWVMEIVEMEKLTDYTCNPEFETEYNKLMAQKDAFMKNLHLYNSMTIERVGSVDLVKPRNSPHLLDQAFDLRMRLVAYWSIVQ… |
| A0A6I9QL60 | 7-157 | YTTNPDYLKKWGELMGGHDAFTKNYFGQSSLVLPGFGEVDVGHLRQYAAMAEQAFDMRMRIMAYWKIVVLRLVETVGLHIICSVNRL… |
| A0A6A6ME73 | 46-180 | None |
| A0A6A6M4E2 | 26-195 | None |
| A0A6J5WKB5 | 5-151 | None |
| A0A7J7PA35 | 160-331 | None |
| A0A834YAD0 | 26-188 | None |
| A0A1R3JDK5 | 2-171 | None |
| A0A7J7NVC3 | 160-323 | None |
| A0A6A6MI22 | 82-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.